PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G26950.1
Common NameAtMYB104, MYB104, T20P8.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 382aa    MW: 43512.6 Da    PI: 4.8963
Description myb domain protein 104
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G26950.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.52.6e-121865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     + +W +eEd +l+d+v q+G +tW+ ++++ g+   + +c+ rw ++l
      AT2G26950.1 18 KSKWKPEEDRILKDYVIQYGDRTWTHVPKRTGLPHNPASCRFRWMNHL 65
                     679*****************************8899**********96 PP

2Myb_DNA-binding47.93.2e-1571113145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +g++T eE+++ +++++ lG++ W+  ar+++ gRt++++k++w+
      AT2G26950.1  71 KGPFTDEEEKRVLQLHAVLGNK-WSQMAREFP-GRTDNEIKNFWN 113
                      79********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.0091369IPR017930Myb domain
SMARTSM007171.4E-91767IPR001005SANT/Myb domain
SuperFamilySSF466897.94E-2417112IPR009057Homeodomain-like
PfamPF002491.3E-91865IPR001005SANT/Myb domain
CDDcd001673.90E-82065No hitNo description
Gene3DG3DSA:1.10.10.602.2E-182072IPR009057Homeodomain-like
PROSITE profilePS5129417.36970120IPR017930Myb domain
SMARTSM007178.1E-1370118IPR001005SANT/Myb domain
PfamPF002493.4E-1371113IPR001005SANT/Myb domain
CDDcd001671.84E-1073113No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2273115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MIQDQANDLL AMKKTFTKSK WKPEEDRILK DYVIQYGDRT WTHVPKRTGL PHNPASCRFR  60
WMNHLKPSLK KGPFTDEEEK RVLQLHAVLG NKWSQMAREF PGRTDNEIKN FWNARRMRLK  120
GKGLPVYPDE VREQAIRTAA QYGVKVELLN AHYSQDSLMA GNVEKPQELN NLALNQCSPY  180
YQSTLANVQP SRNRVMEPET TFPFTGGSAM NEQNPTLLCN PYVESTQEQL PDSHLFGNVT  240
YSSPPMPLIH EVENLELPSF QGFDFHEEPS SFGAEQYNPM LNLEPHNTLV QSPLIGQTPT  300
DFPSSFYDEL LDELLESVVN GSLGEIPKTD TSSESQLFQS SLRSHTDATP DIANTTGYVG  360
SNERNTTNDD DWIRLLLDEG FI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-23161145102B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402545390.0
Genevisible266862_at0.0
Expression AtlasAT2G26950-
AtGenExpressAT2G26950-
ATTED-IIAT2G26950-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G26950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G26950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0051680.0AC005168.3 Arabidopsis thaliana chromosome 2 clone F12C20 map B68, complete sequence.
GenBankAC0056230.0AC005623.3 Arabidopsis thaliana chromosome 2 clone T20P8 map B68, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180263.50.0myb domain protein 104
SwissprotQ9SM270.0MY104_ARATH; Transcription factor MYB104
TrEMBLD7LFE91e-156D7LFE9_ARALL; Putative uncharacterized protein
STRINGAT2G26950.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91982138
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Michael TP,McClung CR
    Enhancer trapping reveals widespread circadian clock transcriptional control in Arabidopsis.
    Plant Physiol., 2003. 132(2): p. 629-39
    [PMID:12805593]
  4. Achard P,Herr A,Baulcombe DC,Harberd NP
    Modulation of floral development by a gibberellin-regulated microRNA.
    Development, 2004. 131(14): p. 3357-65
    [PMID:15226253]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Paz-Ares J
    REGIA, an EU project on functional genomics of transcription factors from Arabidopsis Thaliana.
    Comp. Funct. Genomics, 2002. 3(2): p. 102-8
    [PMID:18628849]

  7. MEDIATOR25 acts as an integrative hub for the regulation of jasmonate-responsive gene expression in Arabidopsis.
    Plant Physiol., 2012. 160(1): p. 541-55
    [PMID:22822211]